<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1149 CA33303 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDI NA
3 3TC+AZT+SQV 74
4 3TC+D4T+NFV 39
5 DDI+NVP+IDV NA
6 D4T+DDI+NVP+IDV 59
7 Unknown 116

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T L10IV, I13IV, I62V, L63P, T74S, V77I, I93L  
>CA33303| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKAITSVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74LV, L210W, T215Y   K103KN, Y181YC   K43Q, T69TN, K122E, S162C, M184X, R211K, L228HR, V245E, K277R, T286A, E291D, E297K  
>CA34318| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSNKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYXDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTDVIPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005