<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1836 CA33302 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ D4T+ DDC+ DDI NA
2 IDV+ NFV+ RTV NA
3 D4T+ DLV+ NFV NA
4 3TC+ D4T+ RTV+ SQV 24
5 3TC+ D4T+ NFV+ SQV 7
6 3TC+ ABC+ NFV+ SQV 24
7 None 7
8 3TC+ AZT+ NVP+ IDV+ RTV 33
9 Unknown 77

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58QE L10I, K20R, E35D, M36I, I62V, L63P, A71V, T74S, I93L  
>CA33302| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVREYD
QVPIEICGHKVIGSVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q K103N   V35R, K46KQ, D123E, D177E, G196GE, T200I, I202V, R211K, A272P, I293V  
>CA34317| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICTEMEKEGQISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRIKVEELRQHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005