<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1499 CA33301 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 44
2 DDI 126
3 D4T 52
4 3TC+D4T 65
5 3TC+D4T+IDV 58
6 D4T+NFV+NVP 63
7 3TC+D4T+EFV+RTV+SQV 13
8 APV+D4T+EFV+NFV 30
9 APV+D4T+NFV 28
10 None 56

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L10F, Q58E, G73S, L89V K20R, E35D, M36I, N37Q, I62V, L63P, A71V, V77T, I93L  
>CA33301| codons 1-99
PQITLWQRPFVTIKIGGQLREALLDTGADDTILEDIQLPGRWKPKIVGGIGGFLKVREYD
QVPIEICGHKVISTVLTGPTPVNVIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   K103N, Y181C, G190A   K20R, V35M, T39A, K43E, E44D, V118I, D123E, Q174QR, D177E, G196E, E203K, Q207E, H208Y, R211K, K223Q, A272P, T286A  
>CA34316| codons 1-291
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPEIVI
CQYMDDLYVASDLEIEQHRTKIKELREYLWKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005