<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DEMD11UG003 DEMD11UG003 Uganda 2011 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, R41K, R57K, Q61H, L63S, I64V, E65D, V77I  
>DEMD11UG003| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVKQYD
HISVDICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, V60I, K122E, D123N, D177E, I178M, T200I, Q207E, R211K, P243T, V245T, D250E, A272P, K277R, L282C, L283I, A288T, I293V, I329V, Q334P, G335D, P345Q, F346Y, R356K, M357L, A360T, T369A, E370A, A376S, T377Q, S379C, K390R, A400I, E404D, V435I, T470A, H483N, S519N, A534S, A554S  
>DEMD11UG003| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYMDDLYVGSDLEIGQHRIKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQTITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCIRGTKTLTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGPDQWTYQIYQEQYKNLKTGKYAKLRGT
HTNDVKQLAAAVQKISQECIVIWGKTPKFRLPIQKETWEIWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLADTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSSGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, V31I, M50L, I72V, L101I, T112V, I113V, T122I, T124A, T125A, D167E, V201I, L234I, A265V  
>DEMD11UG003| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEALHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVVHTDNGSN
FISAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Hora, B Genetic characterization of a panel of diverse HIV-1 isolates at seven international sites. PLoS ONE, 2015