<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2206 CA33273 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 SQV 52
2 3TC+AZT+IDV 135
3 3TC+D4T+EFV+NFV 78
4 3TC+D4T+DDI+LPV 81

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M L10F, L33F, G73C L19I, L24M, N37H, I62V, L63P, I64V, I66V, T74S, V77I  
>CA33273| codons 1-99
PQITLWQRPFVTIKIGGQIKEALMDTGADDTVFEEMHLPGRWKPKIVGGIGGFVKVRQYD
QVPVEVCGHKAICSVLIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y     K101H E28EA, K43Q, E44ED, V60I, V118I, K122E, I135T, T200TA, R211K, A272P, Q278H, I293V  
>CA34290| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALVEICTELEQDGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005