<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8049 CA33269 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 78
2 D4T+DDI+NFV 135
3 D4T+DDI+RTV+SQV 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, I54V, L90M N88D L10LR, I13IV, K20R, E35D, M36I, N37T, I62V, L63P, A71X  
>CA33269| codons 1-99
PQITLWQRPRVTVKIGGQLREALLDTGADNTVLEDITLPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKXIGTVLVGPTPVNIIGRDLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R       V35L, R83K, K101KR, S163SG, D177E, I178M, V179VI, G196E, T200A, E204N, R211K, V245E, A272P, T286A, E297K  
>CA34284| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSGMTKILEPFRKQNPEMII
YQYMDDLYVGSDLEIEQHRAKIENLRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005