<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5258 CA33251 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 125
2 3TC+AZT+NFV 104
3 None 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, L63Q  
>CA33251| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIQIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V     V108I T69S, D121C, K122E, K166R, D177E, I178IL, T200A, Q207E, R211RK, A272P, K277R, E297K  
>CA34266| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
CEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPELVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005