<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3276932 3276932 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ 3TC+ AZT+ ABC 73

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, T12S, G17D, L19I, K20R, M36I, R41K, L63AT, H69K, I72EV, I93L  
>3276932| codons 1-99
PQITLWQRPMVSIKIGDQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAEGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V F116FY K101E, V106M, Y181YC, G190GA   K11KE, K22X, V35T, T39E, S48T, S68R, K122E, D123N, E138S, K173T, Q174K, I180V, T200A, I202V, Q207E, R211K, F214L, H221HY, V245Q, E248D, D250E, A272P, K275Q, Q278N, K281R, T286A, E291D, V292I, I293V, E297K, I326T K13K*, K20RW, L26LF, R72RI
>3276932| codons 1-333
PISPIETVPVEL*PGMDGPWVXQWPFTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKRKDRTKWIKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSMTVLDVGDAYYSVPL
DENFRKYTAFTIPSINNSTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPDIVV
CQYVDDLYVASDLEIGQHRAKVEELREHLLKWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIQVKNLCRLLRGAKALTDIVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLTAEIQKQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005