<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3276932 3276932 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ 3TC+ AZT+ ABC 73

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, T12S, G17D, L19I, K20R, M36I, R41K, L63AT, H69K, I72EV, I93L  
>3276932| codons 1-99
PQITLWQRPMVSIKIGDQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAEGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005