<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3023939 3023939 U.K. 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDI 105
3 3TC+APV+D4T 52
4 D4T+DDI+EFV+LPV 144
5 D4T+DDI+EFV+LPV 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, V82F, I84C   L10I, I13V, G16E, K20I, E35D, M36I, N37NK, R41K, L63M, H69K, K70R, T74S, L89M  
>3023939| codons 1-99
PQITLWQRPIVTVKIEGQLIEALLDTGADDTVLEDIKLPGKWKPKIIGGIGGFIKVRQYD
QIMIEICGKRAIGSVVVGPTPFNCIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70G, L210W, T215Y D67E K101E, Y181C, Y188L   V8VG, T27S, V35T, T69S, W88C, K122E, D123N, I135V, S162A, K173T, Q174K, D177E, I178LM, V179M, T200A, Q207D, H221Y, L228H, V245Q, E248D, T286A, E291D, V292I, I293V, P294T, E297K, V317VA, S322T, I326V  
>3023939| codons 1-334
PISPIETGPVKLKPGMDGPKVKQWPLSEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKESSGWRKLVDFRELNKRTQDFCEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPELMI
CQYMDDLLVGSDLEIGQHRAKIEELRDHLWRWGFYTPDKKYQKEPPFHWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTKEAE
LELAENREILKEPVHGAYYDPTKDLVAEIQKQGQ

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005