<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M70004 M70004 U.K. 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 2
2 RTV+ 3TC+ AZT 31
3 NFV+ 3TC+ AZT 165

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, R41K, H69K, L89M, I93L  
>M70004| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V8VG, T27TS, V35AT, E36A, T39X, K43KE, K122E, D123DG, I135T, I142T, S162T, E169EA, K173A, D177E, I178L, V179I, I195L, T200A, Q207K, R211Q, V245K, A272P, T286V, E291D, V292I, I293V, K311R  
>M70004| codons 1-318
PISPIETGPVKLKPGMDGPKVKQWPLSEEKIKALAAICXEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQTSMTKILAPFRAQNPELII
YQYVDDLYVGSDLELGQHRAKIEELRKHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGVKALTDIVPLTEEAE
LELAENREILREPVHGVY

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005