<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F78596 F78596 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ D4T+ DDI 18
2 D4T+ DDI 38
3 DDI 3
4 None 6
5 NVP+ ABC+ AZT 74

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, I15L, K20I, E35D, M36I, L63S, H69K, L89M  
>F78596| codons 1-99
PQITLWQRPIVTVKLGGQLIEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, T215F   G190A   V35R, V60I, K122E, D123N, I135T, V148VG, K173S, V179I, T200A, Q207A, R211S, L228LR, V245Q, D250E, S251N, A272P, E291D, I293V, P294T, E297A, K311R, E312D  
>F78596| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNGLPQGWKGSPAIFQSSMTKILEPFRSQNPDIII
YQYMDDLYVASDLEIGQHRAKIEELRAHLLSWGFFTPDKKHQKEPPFRWMGYELHPDKWT
VQPIQLPEKENWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVTLTAEAE
LELAENREILRDPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005