<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F30356 F30356 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 55
2 3TC+AZT 29
3 D4T+DDI+NFV 201

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, T12S, I15V, L19T, K20R, E35D, M36I, N37H, P39PS, R41K, K45R, L63P, H69KQ, A71I, I93L  
>F30356| codons 1-99
PQITLWQRPIVSIKVGGQTREALLDTGADDTVLEDIHLSGKWKPRMIGGIGGFVKVRQYD
QIPIEICGKKIIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210LW, T215Y       T27S, V35KT, E36EA, T39DG, S48T, K102Q, V118VI, K122E, K173T, Q174K, D177E, G196GE, T200A, Q207A, R211K, V245Q, D250E, A272P, K277R, I293V, E297K, I326V D218DY
>F30356| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALKAICDELEKEGKITKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELRAHLWKWGFYTPYKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005