<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F65163 F65163 U.K. 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ 3TC+ D4T 43
2 None 54
3 ABC+ AZT+ NVP 14
4 3TC+ NVP+ ABC+ AZT 45
5 RTV+ SQV+ DDI+ D4T 74
6 3TC+ ABC+ AZT+ TDF+ NVP 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G17GE, K20I, M36I, R41K, H69K, L89IM  
>F65163| codons 1-99
PQITLWQRPLVTVRIGEQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39LS, E40ED, S162A, K173T, Q174E, T200A, Q207E, R211RK, V245T, D250E, A272P, T286TA, E291ED, V292I, I293V, P294T, S322A, I326V  
>F65163| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLDMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQ

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005