<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M66914 M66914 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 65
2 D4T+ 3TC+ NFV 192

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, N88S   I15V, K20IM, E35ED, M36I, R41RK, L63LP, I64IV, H69K, L89M, I93L  
>M66914| codons 1-99
PQITLWQRPLVTIKVGGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QIPVEICGKKAIGTVLVGPTPVNIIGRSMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215V, K219Q     V21I, V35T, T39E, K43R, T69TS, K122E, D123S, I135V, K173T, Q174K, D177E, Q207E, V245Q, K249Q, A272P, T286A, E291D, V292I, I293V  
>M66914| codons 1-333
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICEEMEREGKISKIGPENPYNTPV
FAIKKKNSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPEQDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005