<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M83284 M83284 U.K. 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ DDI+ D4T 82
2 ABC+ 3TC+ AZT 33

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36L, L63V, H69K, T74S, V82I, L89M, I93L  
>M83284| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEELNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGSVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215FY K219W     S48T, V60I, D121H, K122E, D123S, I142V, S162X, K173T, Q174R, D177E, I178L, T200A, Q207E, R211K, A272P, K277R, T286A, E291D, V292I, I293V V317DN
>M83284| codons 46-321
KITKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKS
VTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQXSMT
KILEPFRTRNPELVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFFTPDWKHQKEP
PFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRG
AKALTDIVPLTEEAELELAENREILKEPVHGDYYDP

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005