<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M86943 M86943 U.K. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ 3TC+ AZT 50

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I N88D T12S, K14R, L63P, I64V, I93L  
>M86943| codons 1-99
PQITLWQRPLVSIRIGGQLKEALLDTGADNTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRDLLTQLGCTLNF

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005