<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F57352 F57352 U.K. 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 37
2 DDI+ 3TC 71
3 D4T+ NVP+ NFV 145
4 ABC+ AZT+ 3TC 62

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   L10LV, I13V, I15V, K20KT, E35D, M36I, R41K, K45KQ, I62IV, H69K, T74TK, L89IM  
>F57352| codons 1-99
PQITLWQRPVVTVKVGGQLTEALLDTGADDTVLEDINLPGKWKPQMIGGIGGFIKVRQYD
QVLIEICGKKAIGKVLVGPTPVNIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F   K103KN V108VI V21I, V35T, T39N, V60I, K122E, D123N, I135T, V148VG, K173A, Q174K, D177E, T200A, Q207A, R211K, E248D, T286A, E291D, V292I, I293V, E297P  
>F57352| codons 1-324
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNGLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVPLTPEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005