<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F56949 F56949 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 58
2 None 40
3 DDI+ D4T+ NFV 154
4 TDF+ DDI+ D4T 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   T12S, I13V, I15V, L19I, K20T, M36I, R41K, K45T, L63P, H69K, I93L  
>F56949| codons 1-99
PQITLWQRPLVSVKVGGQITEALLDTGADNTVLEEINLPGKWKPTMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       V21I, V35T, E36A, T39E, S48T, V118I, K122E, D123G, K173A, D177E, T200A, Q207E, R211K, V245Q, A272P, I274V, Q278H, K281R, T286A, E291D, V292I, I293V, K311R  
>F56949| codons 1-333
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTAICEELEKEGKITKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGVKVKHLCRLLRGAKALTDIVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005