<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M64940 M64940 U.K. 2002 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 3TC+ IDV+ D4T 134
3 D4T+ DDI+ NVP+ NFV 69
4 ABC+ DDI+ LPV 90

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48A, I54V, V82S, L90M L89V L10I, I13A, K14R, K20I, M36I, N37D, R41K, L63P, H69K, A71V  
>M64940| codons 1-99
PQITLWQRPIVTARIGGQLIEALLDTGADDTVLEEIDLPGKWKPKMIAGIGGFVKVRQYD
QIPIEICGKKVIGTVLVGPTPSNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q   A98G E6S, K11T, K20R, V35T, V60I, L109I, K122E, D123S, K173T, D177E, G196E, T200A, I202V, Q207E, R211K, L228H, V245Q, E248D, D250E, A272P, E291D, V292I, I293V, E297T, D324E  
>M64940| codons 1-335
PISPISTVPVTLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVIDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIEQHRAKVEELREHLLKWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTTEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005