<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F16446 F16446 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC 95
2 D4T+ 3TC+ SQV 41
3 NVP+ NFV+ DDI 54
4 DDI+ NFV+ ABC 65
5 NVP+ AZT+ 3TC 48
6 APV+ LPV+ 3TC 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M   L10I, T12S, L19I, K20M, M36I, R41K, D60E, L63P, H69K, L89M, I93L  
>F16446| codons 1-99
PQITLWQRPIVSIKIGGQIMEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVRQYE
QIPIEICGKKAIGTVLVGPTPVNVIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V, T215Y K219KQ Y188L   V35T, T39E, S48T, K64KR, K122E, E138S, V148VG, S162C, K173T, Q174K, D177E, I178L, V179I, G196E, T200A, Q207D, R211K, D237N, V245Q, D250E, I257L, A272S, K281R, E291D, V292I, I293V, E297EK, H315Y  
>F16446| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIRKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNSTPGIRYQYNGLPQGWKGSPAIFQCSMTKILEPFRTKNPELII
YQYVDDLLVGSDLEIEQHRAKIEELRDHLLKWGFYTPDQKHQKEPPFLWMGYELHPNKWT
VQPIQLPEKESWTVNDLQKLVGKLNWASQIYSGIKVKQLCRLLRGTKALTDIVPLTKEAE
LELAENREILKEPVYGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005