<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
F95995 F95995 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ 3TC+ AZT 9

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I13V, I15V, L19I, M36L, N37S, R41K, L63V, H69K, T74S, L89M, I93L  
>F95995| codons 1-99
PQITLWQRPLVSVKVGGQIKEALLDTGADDTVLEELSLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, S48T, V60I, K166R, K173I, Q174K, T200A, Q207G, R211K, D250E, A272T, E291D, V292I, I293V, P294T, I329V, Q334H  
>F95995| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPDIVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYTGIKVKQLCKLLRGTKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGHG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005