<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
00M3878 00M3878 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ 3TC+ D4T 52
2 None 17
3 NFV+ 3TC+ AZT 74

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19IV, M36I, R41K, K43R, D60DE, Q61QE, L63P, H69K, L89M, I93L  
>00M3878| codons 1-99
PQITLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYE
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, Y181C   E28K, K32E, V35T, E36A, T39E, K122E, D123N, K173T, Q174K, D177E, V179I, T200A, Q207D, R211K, H221Y, V245Q, D250E, A272P, K275R, L283I, V292I, I293V Q278G
>00M3878| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIII
CQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIRVKGLCKLIRGTKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005