<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1321 CA3317 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 143
2 3TC+ D4T+ RTV+ SQV 31

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90LM L24LI, L33LF, K43KT, F53FL, T74TP L10LV, I13V, K20KR, A22AV, E35D, M36I, N37ND, I62V, L63P, A71AV, T91TA  
>CA3317| codons 10-99
VVTVKIGGQLREVLIDTGADDTVFEDIDLPGRWTPKIIGGIGGLIKVRQYDQVPIEICGH
KVIGPVLVGPTPVNVIGRNLMAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215Y K219Q     K20R, V35I, A98S, D123E, I135V, S162D, I178L, H208Y, R211RK, K277R  
>CA3316| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLLKWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005