<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
M72003 M72003 U.K. 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 3
2 NFV+ 3TC+ AZT 92
3 NVP+ IDV+ D4T+ DDI+ RTV 120

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, L90M L10F I13V, K14N, I15V, L19I, K20T, E35N, M36I, R41K, K45R, I62IV, L63P, I64V, H69K, K70R, T74S, L89M, I93L  
>M72003| codons 1-99
PQITLWQRPFVTVNVGGQITEALLDTGADDTVLENINLPGKWKPRMIGGIGGFVKVRQYD
QVPVEICGKRAIGSVLVGPTPVNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219E G190S   L26X, T27X, E28EA, K30X, V35T, E36A, T39E, S48T, K101KQ, K122E, I135V, K166R, K173T, D177E, T200A, E203K, Q207E, V245Q, D250E, A272P, V292I, I293V, E297EA, D324E W24WL
>M72003| codons 24-333
LPXXAEXIKALTAICEEMEKEGKITKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKR
TQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSVNNETPGIR
YQYNVLPQGWKGSPAIFQSSMTRILEPFRTQNPEIVIYQYMDDLYVSSDLEIGQHRAKIK
ELREHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWTVQPIQLPEKESWTVNDIQKLVGK
LNWASQIYPGIKVKQLCKLLRGTKALTEIVPLTAEAELELAENREILKEPVHGVYYDPSK
ELIAEIQKQG

References
Author Title Citation
Weber, J Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005