<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-9877 9877-2872 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 70
2 AZT+ DDC 36
3 3TC 32
4 3TC+ DDI+ IDV 38
5 D4T+ SQV 7
6 DDC+ RTV+SQV 12
7 AZT+ NFV+ NVP 28
8 3TC+ D4T+ IDV+ NVP 61
9 NVP+ IDV+ 3TC+ D4T+ APV+ DDI+ ABC 1
10 APV+ DDI+ ABC 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V, L90M L33F, G73T L10I, E34Q, N37D, I62V, L63P, V77I, I93L  
>9877-2872| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFQEMDLPGRWKPKLIGGIGGFIKVRQYD
QVPIEICGHKAITTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184MI, L210W, T215Y   K103N, Y181C   T27P, V35T, T39S, E44D, K122KE, I135T, S162A, D177E, I178L, V179VI, T200A, E203K, Q207E, R211K, K223E  
>9877-2872| codons 21-260
VKQWPLPEEKIKALTEICSELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETP
GIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPELIICQYIDDLYVGSDLEIGQHRA
KIKELREHLWKWGFYTPDKKHQEEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005