<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-9447 9447-113 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 54
2 DDC 49
3 D4T 10
4 NRTI 42
5 3TC+ AZT 22
6 3TC+ DDC+ IDV 18
7 3TC+ NVP+ SQV+ AZT 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L23LIV, G73S L10I, Q61E, I62V, L63P, A71V, I93L  
>9447-113| codons 1-99
PQITLWQRPIVTIKIGGQLKEAVLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
EVPIEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210L*SW, T215Y   V106A V179D K103R, S162C, T200A, Q207G K122K*EQ, F160FL
>9447-113| codons 22-233
KQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKRKSATVLDVGDAYFSVPLDQDFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPAILQCSMTKILEPFRKQNPDIDIYQYVDDLYVGSDLEIGQHRAK
IEELRGHLWRWGFYTPDKKHQKEPPFLWMGYE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005