<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-8549 8549-2869 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 15
2 3TC+ D4T+ NFV 117

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D L63P, I64LV, V77I, I93L  
>8549-2869| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219KQ     V35T, K166KR, I202V, F214FL, A272P  
>8549-2869| codons 21-273
VKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRT
KVEELRQHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL
VGKLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005