<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-8546 8546-2041 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 237
2 AZT+ DDC 55
3 3TC+ AZT 21
4 3TC+ AZT+ DDC 19
5 3TC+ AZT 13
6 3TC+ IDV+ D4T 27
7 IDV+ D4T 50
8 3TC+ D4T 40

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V T215V, K219Q     K64H, T69N, A98S, V118I, V179I, T200E, F214L  
>8546-2041| codons 41-226
MEKEGKISKIGPENPYNTPVFAIHKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGL
KKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIGQHREKIEELRQHLLRWGLVTPDQK
HQKEPP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R57K, L63P, C67S  
>8546-2041| codons 1-90
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEISGHKAIGTVLVGPTPVNIIGRNLL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005