<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-7891 7891-4365 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ DDC+ SQV 71
2 3TC+ DDC 3
3 NFV+ NVP+ DDI 176

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12S, I13IV, K20IMT, N37T, R41K, L63P, A71V, T74S, V77I, I93L  
>7891-4365| codons 1-99
PQITLWQRPLVSVKIGGQLTEALLDTGADDTVLEEMTLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGSVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I135V, S162A, T200A, Q207E, R211K, V245T  
>7891-4365| codons 21-260
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETP
GIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRA
KIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPITLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005