<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
R72036 R72036 Thailand 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   M230L V179D T39K, K43E, K103R, V106I, V111I, V118I, K122E, D123S, K173I, Q174K, D177E, V189I, Q207A, L210S, R211S, L228HR, K238R, V245E G45R
>R72036| codons 38-247
CKELEEERKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKRKSITVLDIGDAYFSIPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRIKNPEIDIYQYVDDLYIGSDLEIGQHRTKIEELRAHLSSWGFYTP
DKKHQKEPPFRWLGYELHPDRWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, K20R, E35D, M36I, R41K, H69K, L89M  
>R72036| codons 4-99
TLWQRPLVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Jiamsakul, A HIV multi-drug resistance at first-line antiretroviral failure and subsequent virological response in Asia. J Int AIDS Soc, 2013