<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-7891 7891-2156 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ DDC+ SQV 71
2 3TC+ DDC 3
3 NFV+ NVP+ DDI 51

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, T12S, K20M, E35D, N37T, R41K, R57K, L63P, A71V, V77I, I93L  
>7891-2156| codons 1-99
PQITLWQRPIVSIKIGGQLMEALLDTGADDTVLEDMTLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKVIGTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I135V, T200M, Q207E, R211K, V245T, A272P D76N
>7891-2156| codons 21-273
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVNFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRM
KIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPITLPEKDSWTVNDIQKL
VGKLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005