<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-7463 7463-3632 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 IDV+ D4T+ 3TC 142
3 D4T+ 3TC 2
4 3TC 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54A, V82A, L90M   L10I, D60E, Q61E, I62V, L63P, A71V, I72V, V77I, I93L  
>7463-3632| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGFAKVRQYE
EVPIEICGHKVVGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K32E, T39A, K43KQ, E44ED, V60VI, V118VI, I135T, I142IV, D177AG, T200AE, E203EK, H208HY, R211K, K223EQ, L228R  
>7463-3632| codons 21-260
VKQWPLTEEKIEALVEICAELEQDGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSTNNETP
GVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVIYQYVDDLYVGSDLEIGQHRE
KIKELRQYLWKWGFYTPDKKHQQEPPFRWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005