<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-7463 7463-2124 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 IDV+ D4T+ 3TC 62

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A, L90M   D60E, Q61E, I62V, L63P, A71V, I72V, V77I, I93L  
>7463-2124| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGFVKVRQYE
EVPIEICGHKVVGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N   V60I, I135T, I142V, D177E, T200A, R211K, K223Q, L228R, A272P  
>7463-2124| codons 41-273
LEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIF
QSSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKK
HQQEPPFRWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005