<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-6659 6659-1914 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 307
2 AZT+ DDI 13
3 3TC+ D4T 90
4 DDC+ IDV+ NVP 3
5 Unknown 14
6 IDV+ NVP+ DDC 3
7 DLV+ 3TC+ AZT 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, L63C, I64V, E65D  
>6659-1914| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QICVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q K103N   D123E, K166R, I202V, Y232X, V245K, A272P  
>6659-1914| codons 41-273
MEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFFTPDQK
HQKEPPFLWMG*ELHPDKWTVQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005