<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-6459 6459-4252 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 14
2 3TC+ NFV+ NVP 22
3 3TC+ NVP+ DDI+ NFV 48
4 3TC+ NVP+ DDI+ NFV 7
5 3TC+ NVP+ DDI+ NFV 14
6 3TC+ DDI+ NFV 11
7 3TC+ DDI+ NFV+ NVP 96

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L19I, R41K, V77I  
>6459-4252| codons 1-93
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRSLLTQI

References
Author Title Citation
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005