Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| SWC-6459 | 6459-4252 | U.S. | 2001 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | 3TC+ D4T+ IDV | 14 |
| 2 | 3TC+ NFV+ NVP | 22 |
| 3 | 3TC+ NVP+ DDI+ NFV | 48 |
| 4 | 3TC+ NVP+ DDI+ NFV | 7 |
| 5 | 3TC+ NVP+ DDI+ NFV | 14 |
| 6 | 3TC+ DDI+ NFV | 11 |
| 7 | 3TC+ DDI+ NFV+ NVP | 96 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, N88S | L19I, R41K, V77I |
| >6459-4252| codons 1-93 PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD QILIEICGHKAIGTVLIGPTPVNIIGRSLLTQI |
References
| Author | Title | Citation |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |