<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-6459 6459-2425 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 14
2 3TC+ NFV+ NVP 22
3 3TC+ NVP+ DDI+ NFV 48
4 3TC+ NVP+ DDI+ NFV 7
5 3TC+ NVP+ DDI+ NFV 14
6 3TC+ DDI+ NFV 5

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S   L19I, R41K, V77I, Q92X  
>6459-2425| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRSLLTHIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E Y181C   V35A, K49R, V60I, I135V, E169D, R211K, D218E, A272P  
>6459-2425| codons 22-273
KQWPLTEEKIKALAEICTEMEKEGKISRIGPENPYNTPIFAIKKKNSTRWRKLVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVICQYVDDLYVGSDLEIGQHRTK
IEELRQHLLKWGFTTPEEKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLV
GKLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005