<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-6100 6100-3787 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 43
2 NRTI 87
3 3TC+ D4T 89
4 RTV+ DDI+ NVP+ SQV 19
5 DDI+ NVP+ SQV 13
6 DDI+ NVP+ SQV+ RTV 15
7 SQV+ RTV 12
8 SQV+ RTV+ NVP+ DDI 1
9 SQV+ RTV+ DDI 9
10 SQV+ RTV+ DDI+ NVP 22
11 SQV+ DDI+ NVP 6
12 DDI+ NVP 6
13 NVP 3
14 SQV+ RTV 2
15 SQV+ RTV+ ABC+ APV+ D4T 1
16 RTV+ ABC+ APV+ D4T 4
17 RTV 1
18 Unknown 14

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D V35VI, I50V, V90VI, K122E, A158S, I202V, R211K, F214L  
>6100-3787| codons 21-260
VKQWPLTEEKIKALIEICTEMEKEGKISKVGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDIDIYQYMDDLYVGSDLEIGQHRT
KVEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84IV Q58QE L10LI, K20KR, E35ED, M36MI, N37X, R57RK, I62IV, L63P, I64IV, A71AITV, V77VI  
>6100-3787| codons 1-92
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIXLPGRWKPKMIGGIGGFVKVKEYD
QVPVEICGHKVIGTVLIGPTPVNVIGRNLLTQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005