<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-6100 6100-3380 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 43
2 NRTI 87
3 3TC+ D4T 89
4 RTV+ DDI+ NVP+ SQV 19
5 DDI+ NVP+ SQV 13
6 DDI+ NVP+ SQV+ RTV 15
7 SQV+ RTV 12
8 SQV+ RTV+ NVP+ DDI 1
9 SQV+ RTV+ DDI 9
10 SQV+ RTV+ DDI+ NVP 22
11 SQV+ DDI+ NVP 6
12 DDI+ NVP 6
13 NVP 3

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V G73GS L10I, E35D, M36I, N37E, I62V, L63P, A71IT, V77I  
>6100-3380| codons 1-92
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDIELPGRWKPKMIGGIGGFVKVRQYD
QVPIEICGHKTISTVLIGPTPVNVIGRNLLTQ

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, Q151M   Y181C   K122E, A158S, I202V, R211K, F214L  
>6100-3380| codons 21-260
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSDKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETP
GIRYQYNVLPMGWKGSPSIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRT
KVEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005