<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-6037 6037-2952 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 IDV+ D4T+ 3TC 88

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   L10I, K20I, E35D, M36I, N37D, L63P, H69Q, A71V, I72V, L89M, Q92R, I93M  
>6037-2952| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEDIDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGQKVVGTVLVGPTPVNVIGRNMMTRMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       T27X, K43E, E44A, A98AS, V118I, D123E, K166R, D177E, E203D, H208Y, R211K, E248D  
>6037-2952| codons 22-260
KQWPLXEEKIKALVEICTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPG
IRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTK
IDELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPDKDSWTVNDIQKL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005