<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5663 5663-2236 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 102
2 D4T+ NFV+ NVP 22
3 D4T 11
4 D4T+ NFV+ NVP 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   Y181C, G190A   K43Q, K122E, D123N, K166R, D177E, I178M, Q197L, E203D, Q207E, R211K, A272P  
>5663-2236| codons 41-273
LEQEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QSSMTRILEPFRKQNPEMVICQYMDDLYVASDLEIGLHRTKIDELREHLWKWGFYTPDKK
HQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, N37D, D60E, Q61E, L63P, I64V, V77I  
>5663-2236| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
EIPVEICGHKAIGTVLIGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005