<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5577 5577-4015 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ D4T 76
2 3TC+ DDC+ IDV 44
3 DDC+ RTV+ SQV 29
4 SQV 3
5 DDI+ NFV+ NVP 41
6 DDI+ NFV+ NVP+ IDV+ 3TC+ AZT 4
7 NVP+ IDV+ 3TC+ AZT 6
8 IDV+ 3TC+ AZT 88
9 3TC+ AZT 5
10 3TC+ AZT+ APV 27

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   Y181C, G190A   K43Q, E44D, K101Q, V118I, K122E, I135V, I142V, S162C, E203D, Q207D, H208Y, R211K, H221Y, V245E, E248D  
>5577-4015| codons 23-260
QWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNK
RTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGV
RYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVICQYVDDLYVASDLEIGQHRTKI
DELRDYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWTVQPIELPDKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73T L10LI, K14KR, R41RK, I62V, L63P, I66L, V77I, I93L  
>5577-4015| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYD
QVPIELCGHKAITTVLIGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005