<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5577 5577-2204 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ D4T 76
2 3TC+ DDC+ IDV 44
3 DDC+ RTV+ SQV 29
4 SQV 3
5 DDI+ NFV+ NVP 41
6 DDI+ NFV+ NVP+ IDV+ 3TC+ AZT 4
7 NVP+ IDV+ 3TC+ AZT 6
8 IDV+ 3TC+ AZT 22

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73T L10I, K14R, N37Y, R41K, I62V, L63P, V77I, I93L  
>5577-2204| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMYLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAITTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   K103KN, Y181C, G190A V108I E44D, K101X, K122E, I135V, S162C, E203D, Q207D, R211K, H221Y, V245E, E248D F116FL, R172RS
>5577-2204| codons 22-258
KQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELN
KRTQDFWEVQLGIPHPAGLXKNKSVTILDVGDAYLSVPLDEDFRKYTAFTIPSVNNETPG
IRYQYNVLPQGWKGSPAIFQCSMTKILEPFSKQNPDIVICQYVDDLYVASDLEIGQHRTK
IDELRDHLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWTVQPIELPDKDSWTVNDIQ

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005