<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5577 5577-1838 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ D4T 76
2 3TC+ DDC+ IDV 44
3 DDC+ RTV+ SQV 29
4 SQV 3
5 DDI+ NFV+ NVP 41
6 DDI+ NFV+ NVP+ IDV+ 3TC+ AZT 4
7 NVP+ IDV+ 3TC+ AZT 6
8 IDV+ 3TC+ AZT 1

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   Y181C, G190A V108I E44X, K122E, I135V, S162C, V189I, E203D, Q207HN, R211K, V245E, E248D, K259X, A272P F116FL
>5577-1838| codons 22-273
KQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELN
KRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYLSVPLDEDFRKYTAFTIPSVNNETPG
IRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVICQYVDDLYIASDLEIGQHRTK
IDELRNHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPDKDSWTVNDIQNLV
GKLNWASQIYPG

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005