<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5550 5550-2777 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 29
2 D4T+ DDI+ SQV 26
3 DDC+ NFV+ NVP 7
4 NFV+ NVP+ DDC+ DDI 1
5 NFV+ NVP+ DDC 7
6 IDV+ 3TC+ AZT 55
7 DDI+ NFV+ EFV 16
8 EFV 4
9 EFV+ ABC+ APV+ D4T 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L10F I13IV, K20KM, E35D, M36I, N37S, K45R, Q61QR, L63P, L89M, I93L  
>5550-2777| codons 1-95
PQITLWQRPFVTVKIGGQLMEALLDTGADDTVLEDISLPGRWKPRMIGGIGGFIKVRQYD
RIPIEICGHKAIGTVLVGPTPVNVIGRNMMTQLGC

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F   K103N   V118I, D121DN, K122E, D123N  
>5550-2777| codons 21-160
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFREL
NKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAFFSIPLNENFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005