<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5550 5550-1850 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 29
2 D4T+ DDI+ SQV 26
3 DDC+ NFV+ NVP 7
4 NFV+ NVP+ DDC+ DDI 1
5 NFV+ NVP+ DDC 7
6 IDV+ 3TC+ AZT 55

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V K103N   V118I, K122E, D123N, V179I, Q197K, R211K, F214L, L228H  
>5550-1850| codons 21-233
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIGKHRT
KIEELRQHLLKWGLTTPDKKHQKEPPFHWMGYE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L10F E35D, M36I, N37S, K45R, L63P, I64X, L89M, I93L  
>5550-1850| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDISLPGRWKPRMIGGIGGFIKVRQYD
QIPXEICGHKAIGTVLVGPTPVNVIGRNMMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005