<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-5550 5550-951 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 29
2 D4T+ DDI+ SQV 26
3 DDC+ NFV+ NVP 7
4 NFV+ NVP+ DDC+ DDI 1
5 NFV+ NVP+ DDC 7

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R V75S K103N, Y181C V108I V118I, K122E, D123N, L187X, Q197K, R211K, F214L, L228H  
>5550-951| codons 21-233
VKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKRKDSTKWRKLSDFREL
NKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPLDENFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDFYVGSDLEIGKHRT
KIEELRQHLLKWGLTTPDKKHQKEPPFHWMGYE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V L10F L23X, E35D, M36I, N37S, K45R, L63P  
>5550-951| codons 1-88
PQITLWQRPFVTIKIGGQLKEAXLDTGADDTVLEDISLPGRWKPRMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNVIGRN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005