<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-4603 4603-4823 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 211
2 AZT+ DDC 118
3 AZT 59
4 AZT+ EFV+ 3TC 15
5 EFV+ 3TC+ AZT+ NVP 1
6 3TC+ AZT+ NVP 1
7 3TC+ AZT 113
8 APV+ D4T+ 3TC 1
9 D4T+ 3TC 2
10 D4T+ 3TC+ NFV 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N   K43Q, A98S, I135T, T200A  
>4603-4823| codons 21-260
VKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFREL
NKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRA
KIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   G16E, E35D, M36MI, L63T, I64V  
>4603-4823| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QITVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005