<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-4603 4603-2140 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 211
2 AZT+ DDC 118
3 AZT 59
4 AZT+ EFV+ 3TC 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       A98S, K101R, I135T, I142IFLV, A272P K122K*EQ
>4603-2140| codons 22-273
KQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPSGLRKKKSVTVLDVGDAYFSVPLDQDFRKYTAFTIPSTNNETPG
VRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTK
IEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLV
GKLNWASQIYPG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35D, L63T, I64V, Q92QH, I93IM, F99FL  
>4603-2140| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QITVEICGHKAIGTVLVGPTPVNIIGRNLLTHMGCTLNL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005