<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-4546 4546-4960 U.S. 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 D4T+ 3TC+ NVP 13
3 3TC+ NVP 3
4 3TC+ NVP+ DDI 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V   Y181C, G190A   T69S, K122E, F171Y, G196E, T200A, V245E  
>4546-4960| codons 21-260
VKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSSKWRKVVDFREL
NKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETP
GIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIVICQYVDDLYVASDLEIEQHRA
KIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P  
>4546-4960| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005