<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SWC-4520 4520-2566 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 NRTI 186
3 3TC+ AZT 8
4 3TC+ D4T+ IDV 81
5 3TC+ AZT+ IDV 61
6 DDI+ D4T+ NFV+ EFV 24
7 NFV+ EFV 1
8 EFV 2
9 Unknown NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, N37D, K45R, I62V, L63T, C67S, V77I, I93L  
>4520-2566| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPRMIGGIGGFIKVRQYD
QVTIEISGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I37F, V60VI, I135T, I178M, Q207K, R211S, A272P  
>4520-2566| codons 33-273
ALVEFCTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQG
WKGSPAIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVGSDLEIGQHRTKIEELRKHLLSW
GFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYP
G

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005